PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G106400.1.p
Common NameGLYMA_04G106400, LOC100812543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 213aa    MW: 23382.7 Da    PI: 9.0048
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G106400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.9e-4371061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql
  Glyma.04G106400.1.p   7 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDAIKSLAYEAEARLRDPVYGCVGLISILQHRLKQL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+++k+e
  Glyma.04G106400.1.p  97 QSELHRAKKE 106
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7576107IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MSSSNSPCAA CKIQRRKCTQ ECVFAPYFPP DNPQRFAYVH KVFGASNVAK LLNELNAAQR  60
EDAIKSLAYE AEARLRDPVY GCVGLISILQ HRLKQLQSEL HRAKKELASY VGPQAMLPPP  120
PPPPLLPPQS PRTFSLFPFK TAPTNQQDLF GFHDDGGASA SHGVLNHHLA LFSPSPAVDH  180
AFSHPPMHSL ALPHHSHLTR SPMQPRHQTD PA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578337.11e-154PREDICTED: LOB domain-containing protein 36-like
RefseqXP_006578338.11e-154PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-68LBD36_ARATH; LOB domain-containing protein 36
TrEMBLK7KJC71e-154K7KJC7_SOYBN; Uncharacterized protein
STRINGGLYMA04G11991.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-67ASYMMETRIC LEAVES 2-like 1